PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000186-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 288aa    MW: 32831.9 Da    PI: 5.1252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000186-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l++ +   G  +W+++++  g+ R++k+c++rw +yl
    NNU_000186-RA 14 KGPWTADEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding521.6e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++  +d++++lG++ W++Ia++++ gRt++++k++w+++
    NNU_000186-RA  70 LSESEEQMVIDLHARLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.046961IPR017930Myb domain
SuperFamilySSF466891.01E-2611108IPR009057Homeodomain-like
SMARTSM007177.5E-121363IPR001005SANT/Myb domain
PfamPF002495.4E-141461IPR001005SANT/Myb domain
CDDcd001674.96E-81661No hitNo description
PROSITE profilePS5129426.78662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2564116IPR009057Homeodomain-like
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002498.7E-1570111IPR001005SANT/Myb domain
CDDcd001673.09E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAD EDKKLINFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SESEEQMVID LHARLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHKPIS ISIDQPQQQK QPEQEKCSVA AICEEDQNKG PETSLQSSVT EITEEEKSST  180
SPFSHTEKND AFCTDEVPMI EFDEILAPCL PSSSTSSSSS SSGSSGMLED LQFSSFDWLQ  240
YDNNGFWDDF NYWDLICEDG DRKLAVDSPP REYPRIVLDQ ESWKFELL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268020.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX66e-85ODO1_PETHY; Protein ODORANT1
TrEMBLA0A061EGV91e-123A0A061EGV9_THECC; Myb domain protein 20
STRINGVIT_14s0006g00450.t011e-119(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.12e-89myb domain protein 20